Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 26 (Gpr26)

This Recombinant Mouse G-protein coupled receptor 26 (Gpr26) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

G-protein coupled receptor 26

UniProt

Q8BZA7

Expression Region

1-337

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSWDAGLAGLLVGTIGVSLLSNGLVLLCLLHSADIRRQAPALFTLNLTCGNLLCTVVNM PLTLAGVVAQRQPAGDRLCRLAAFLDTFLAANSMLSMAALSIDRWVAVVFPLSYRAKMRL RDAAFMVAYTWLHALTFPATALALSWLGFHQLYASCTLCSRRPDERLRFAVFTSAFHALS FLLSFIVLCFTYLKVLKVARFHCKRIDVITMQTLVLLVDIHPSVRERCLEEQKRRRQRAT KKISTFIGTFLVCFAPYVITRLVELFSTAPIGSHWGVLSKCLAYSKAASDPFVYSLLRHQ YRRSCKELLNRIFNRRSLHSVGLTGDSHSQNILPVSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASCC1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV628766 1.0 µg DNA

ASCC1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
TRNAS15 Protein Vector (Human) (pPB-C-His)
PV140154 500 ng

TRNAS15 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant human IMP Dehydrogenase 1/IMPDH1 protein
ATGP0586-250 250 µg

Recombinant human IMP Dehydrogenase 1/IMPDH1 protein

Sign In for Pricing
View Details
Tris (tridecyl) Trimellitate
468313 100 mg

Tris (tridecyl) Trimellitate

Sign In for Pricing
View Details
Splicing factor 1 (SF1) (NM_201995) Human Over-expression Lysate
LH16488V 100 µg

Splicing factor 1 (SF1) (NM_201995) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Bordetella Parapertussis hisG Protein (aa 1-223)
VAng-Lsx2645-1mgEcoli 1 mg (E. coli)

Recombinant Bordetella Parapertussis hisG Protein (aa 1-223)

Sign In for Pricing
View Details