Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 2 (Taar2)

This Recombinant Rat Trace amine-associated receptor 2 (Taar2) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 2, TaR-2, Trace amine receptor 2, G-protein coupled receptor 58

UniProt

Q5QD25

Expression Region

1-339

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSFEAQQETFDCSEYGNGSCPENERSLGVRAAMYSLMAGAIFITIFGNLVMIISISYFK QLHTPTNLLILSMAVTDFLLGFTIMPYSMVRSVENCWYFGLTFCKIHYSFDLMLSITSIF HLCSVAIDRFYAICHPLHYCTKMTIPVVKRLLLVCWSVPGAFAFGVVFSEAYADGIEGYD ILVACSSSCPVMFNKLWGTTLFVAGFFTPSSMMVGIYGKIFAVSKKHARVIDNLPENQNN QMRKDKKAAKTLGIVMGVFLLCWFPCFFTILLDPFLNFSTPAILFDALTWFGYFNSTCNP LIYGFFYPWFRRALRYILLGKIFSSHFHNTNLFTQKETE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Raja 42
TRC-R080000-500MG 500 mg

Raja 42

Sign In for Pricing
View Details
Zinc Difluoride
TRC-Z439690-50G 50 g

Zinc Difluoride

Sign In for Pricing
View Details
TLE 1 Recombinant Rabbit Monoclonal Antibody [JE41-40]
HA722702 100 µL

TLE 1 Recombinant Rabbit Monoclonal Antibody [JE41-40]

Sign In for Pricing
View Details
Human IgM, AlpSdAbs® VHH
HA710278 100 µg

Human IgM, AlpSdAbs® VHH

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF488A conjugate, 0.1mg/mL
BNC882039-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Car1 Mouse Gene Knockout Kit (CRISPR)
KN502525 1 Kit

Car1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details