Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Violet-sensitive opsin

This Recombinant Chicken Violet-sensitive opsin spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Violet-sensitive opsin, Violet cone opsin, Violet cone photoreceptor pigment

UniProt

P28684

Expression Region

1-347

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSDDDFYLFTNGSVPGPWDGPQYHIAPPWAFYLQTAFMGIVFAVGTPLNAVVLWVTVRY KRLRQPLNYILVNISASGFVSCVLSVFVVFVASARGYFVFGKRVCELEAFVGTHGGLVTG WSLAFLAFERYIVICKPFGNFRFSSRHALLVVVATWLIGVGVGLPPFFGWSRYMPEGLQC SCGPDWYTVGTKYRSEYYTWFLFIFCFIVPLSLIIFSYSQLLSALRAVAAQQQESATTQK AEREVSRMVVVMVGSFCLCYVPYAALAMYMVNNRDHGLDLRLVTIPAFFSKSACVYNPII YCFMNKQFRACIMETVCGKPLTDDSDASTSAQRTEVSSVSSSQVGPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chicken Indian hedgehog protein (IHH)
CSB-EP839652CH-01 10 µg

Recombinant Chicken Indian hedgehog protein (IHH)

Sign In for Pricing
View Details
Recombinant Chicken Indian hedgehog protein (IHH)
CSB-EP839652CH-02 50 µg

Recombinant Chicken Indian hedgehog protein (IHH)

Sign In for Pricing
View Details
Recombinant Chicken Indian hedgehog protein (IHH)
CSB-EP839652CH-03 200 µg

Recombinant Chicken Indian hedgehog protein (IHH)

Sign In for Pricing
View Details
Recombinant Chicken Indian hedgehog protein (IHH)
CSB-EP839652CH-04 500 µg

Recombinant Chicken Indian hedgehog protein (IHH)

Sign In for Pricing
View Details
Recombinant Chicken Indian hedgehog protein (IHH)
CSB-EP839652CH-05 20 µg

Recombinant Chicken Indian hedgehog protein (IHH)

Sign In for Pricing
View Details
Recombinant Chicken Indian hedgehog protein (IHH)
CSB-EP839652CH-06 100 µg

Recombinant Chicken Indian hedgehog protein (IHH)

Sign In for Pricing
View Details