Recombinant Chicken Indian hedgehog protein (IHH)
Product Specifications
Product Name Alternative
(IHH)
Abbreviation
Recombinant Chicken IHH protein
Gene Name
IHH
UniProt
Q98938
Expression Region
24-408aa
Organism
Gallus gallus (Chicken)
Target Sequence
CGPGRVVGSRRRPPRKLIPLAYKQFSPNVPEKTLGASGRYEGKIARNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGMLARLAVEAGFDWVYYESKAHIHCSVKSEHSAAAKTGGCFPGRALATLENGARTPLWALRPGQRVLAMDGAGRPTYSDFLAFLDKEPRALTAFHVIETRQPPRRLALTPTHLLFVADNASAPAAQFRPTFASHVQPGHFVLVAVGSGGLQPAEVVGVRGRTDVGAYAPLTRHGTLVVDDVVASCFALVREQQLAQMAFWPLRLYHSLLGGPGVQGDGVHWYSGLLYRLGRMLLPPDSFHPLGAPRAES
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Type
Developed Protein
Source
E.coli
Field of Research
Others
Relevance
[Indian hedgehog protein]: The C-terminal part of the indian hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein into two parts followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product. Both activities occur in the reticulum endoplasmic. ; [Indian hedgehog protein N-product]: The dually lipidated indian hedgehog protein N-product is a morphogen which is essential for a variety of patterning events during development. Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. Plays a role in morphogenesis of the skeleton by coordinating growth and differentiation of the endochondral skeleton. Positively regulates PTHLH expression during endochondral bone formation preventing chondrocyte hypertrophy. In contrast, participates in normal chondrocyte proliferation in a PTHLH-independent pathway.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
47.5 kDa
References & Citations
"Indian hedgehog and syndecans-3 coregulate chondrocyte proliferation and function during chick limb skeletogenesis." Shimo T., Gentili C., Iwamoto M., Wu C., Koyama E., Pacifici M. Dev Dyn 229:607-617 (2004)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog