Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-7 (srb-7)

This Recombinant Serpentine receptor class beta-7 (srb-7) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-7, Protein srb-7

UniProt

P54142

Expression Region

1-348

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNESSTNIPLACITAYELSFHPVYRNFQIYQLIMLFSSLFPLTYFILFQLLKSSFHGNLK SLLVGYFGAILVFSVVFLVEAFIQVLLPFISEQKCDLLIQPKYYKLGNLLGCLLMTIPTF FPISITFERLIATKMADDYEKTRVFLGPILAIFLVLLDLFLILLIYKEAIVTGGSISFVF IPASIASKMYMFFIMMLILNSFNFFFSFLLLRRNAQLKKSNSTLAAKFQLEEVYSSTKFS ISVIFVHVTFFGSYTTITILLRYFGSYFFSDPIDLGAVRGAFMTMISSYNFAVGVASVYF NYIYRIKKIIEIKGNIRIVATGQAGAINYDKAIFNIWNSTSSTNNTSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plant Fibroblast Growth Factor Receptor 5 (FGFR5) ELISA Kit
MBS9381798 Inquire

Plant Fibroblast Growth Factor Receptor 5 (FGFR5) ELISA Kit

Sign In for Pricing
View Details
5-Fluoro-2-methylphenyl Isocyanate
436503-01 500 mg

5-Fluoro-2-methylphenyl Isocyanate

Sign In for Pricing
View Details
5-Fluoro-2-methylphenyl Isocyanate
436503-02 1 g

5-Fluoro-2-methylphenyl Isocyanate

Sign In for Pricing
View Details
Recombinant Mouse 5-AMP-activated protein kinase subunit beta-1 (Prkab1)
CSB-EP889918MO-01 10 µg

Recombinant Mouse 5-AMP-activated protein kinase subunit beta-1 (Prkab1)

Sign In for Pricing
View Details
Recombinant Mouse 5-AMP-activated protein kinase subunit beta-1 (Prkab1)
CSB-EP889918MO-02 50 µg

Recombinant Mouse 5-AMP-activated protein kinase subunit beta-1 (Prkab1)

Sign In for Pricing
View Details
Recombinant Mouse 5-AMP-activated protein kinase subunit beta-1 (Prkab1)
CSB-EP889918MO-03 200 µg

Recombinant Mouse 5-AMP-activated protein kinase subunit beta-1 (Prkab1)

Sign In for Pricing
View Details