Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 5-AMP-activated protein kinase subunit beta-1 (Prkab1)

Product Specifications

Product Name Alternative

AMPK subunit beta-1 (AMPKb)

Abbreviation

Recombinant Mouse Prkab1 protein

Gene Name

Prkab1

UniProt

Q9R078

Expression Region

2-270aa

Organism

Mus musculus (Mouse)

Target Sequence

GNTSSERAALERQAGHKTPRRDSSGGAKDGDRPKILMDSPEDADIFHSEEIKAPEKEEFLAWQHDLEANDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYMSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Non-catalytic subunit of AMP-activated protein kinase, an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha and gamma subunits.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.1 kDa

References & Citations

"Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry." Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J. Mol. Cell. Proteomics 8:904-912 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12927300/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

APC/Cy7 Linked Polyclonal Antibody to Neuron Derived Neurotrophic Factor (NDNF)
MBS2110962-01 0.1 mL

APC/Cy7 Linked Polyclonal Antibody to Neuron Derived Neurotrophic Factor (NDNF)

Ask
View Details
APC/Cy7 Linked Polyclonal Antibody to Neuron Derived Neurotrophic Factor (NDNF)
MBS2110962-02 0.2 mL

APC/Cy7 Linked Polyclonal Antibody to Neuron Derived Neurotrophic Factor (NDNF)

Ask
View Details
APC/Cy7 Linked Polyclonal Antibody to Neuron Derived Neurotrophic Factor (NDNF)
MBS2110962-03 0.5 mL

APC/Cy7 Linked Polyclonal Antibody to Neuron Derived Neurotrophic Factor (NDNF)

Ask
View Details
APC/Cy7 Linked Polyclonal Antibody to Neuron Derived Neurotrophic Factor (NDNF)
MBS2110962-04 1 mL

APC/Cy7 Linked Polyclonal Antibody to Neuron Derived Neurotrophic Factor (NDNF)

Ask
View Details
APC/Cy7 Linked Polyclonal Antibody to Neuron Derived Neurotrophic Factor (NDNF)
MBS2110962-05 5 mL

APC/Cy7 Linked Polyclonal Antibody to Neuron Derived Neurotrophic Factor (NDNF)

Ask
View Details
APC/Cy7 Linked Polyclonal Antibody to Neuron Derived Neurotrophic Factor (NDNF)
MBS2110962-06 5x 5 mL

APC/Cy7 Linked Polyclonal Antibody to Neuron Derived Neurotrophic Factor (NDNF)

Ask
View Details