Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Rhodopsin (RHO)

This Recombinant Sheep Rhodopsin (RHO) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

P02700

Expression Region

1-348

Origin

Ovis aries (Sheep)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP QGMQCSCGALYFTLKPEINNESFVIYMFVVHFSIPLIVIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKSSSV YNPVIYIMMNKQFRNCMLTTLCCGKNPLGDDEASTTVSKTETSQVAPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH2D2A Peptide - middle region
orb2000558 100 µg

SH2D2A Peptide - middle region

Sign In for Pricing
View Details
IKK gamma Rabbit Polyclonal Antibody (FITC)
orb2448654 100 µL

IKK gamma Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
ICAM1 Rabbit Polyclonal Antibody (FITC)
orb2099160 100 µL

ICAM1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
IQSEC2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1097108 1.0 µg DNA

IQSEC2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Human Interleukin 23 Subunit Alpha (IL23a)
RPU42281-01 50 µg

Recombinant Human Interleukin 23 Subunit Alpha (IL23a)

Sign In for Pricing
View Details
Recombinant Human Interleukin 23 Subunit Alpha (IL23a)
RPU42281-02 100 µg

Recombinant Human Interleukin 23 Subunit Alpha (IL23a)

Sign In for Pricing
View Details