Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH2D2A Peptide - middle region

SH2D2A Peptide - middle region

Product Specifications

Product Name Alternative

SCAP, TSAD, VRAP, F2771

UniProt

Q9NP31

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH2D2A Rabbit Polyclonal Antibody (orb589340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001154914.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEPAGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAPVPMQKEGAGEKEPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMTK3 Rabbit Polyclonal Antibody (Fluoro647)
orb3098764 100 µg

LMTK3 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
SPRR2D CRISPR Activation Plasmid (m)
sc-423139-ACT 20 µg

SPRR2D CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
GOLGA6L2 Antibody - N-terminal region
MBS3218501-01 0.1 mL

GOLGA6L2 Antibody - N-terminal region

Sign In for Pricing
View Details
GOLGA6L2 Antibody - N-terminal region
MBS3218501-02 5x 0.1 mL

GOLGA6L2 Antibody - N-terminal region

Sign In for Pricing
View Details
ASB2 Protein Vector (Rat) (pPM-C-HA)
PV254860 500 ng

ASB2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Shigella Flexneri lplT Protein (aa 1-396)
VAng-Lsx07892-inquire Inquire

Recombinant Shigella Flexneri lplT Protein (aa 1-396)

Sign In for Pricing
View Details