Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecus solatus C-C chemokine receptor type 5 (CCR5)

This Recombinant Cercopithecus solatus C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q9BGN6

Expression Region

1-352

Origin

Cercopithecus solatus (Sun-tailed monkey)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTIPFWAHYAAAQWDFGNTMCQLLTGLYLIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGLVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPSSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHLAKRFCKCCSISQQEAPERASSVYTRSTGEQETTVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Alpha amylase 2B (AMY2B) ELISA kit
GTR10371755 96 Well

Guinea Pig Alpha amylase 2B (AMY2B) ELISA kit

Sign In for Pricing
View Details
Chicken Stromal cell derived factor 1β ELISA Kit
GTR10338387 96 Well

Chicken Stromal cell derived factor 1β ELISA Kit

Sign In for Pricing
View Details
NHEDC2 CRISPR Knock Out 293T Cell Line (Human)
31807141 1x 10^6 Cells / 1.0 mL

NHEDC2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
2-Cyclopropylcarbonyl-3-dimethylaminoacrylic Acid Methyl Ester
159533 500 mg

2-Cyclopropylcarbonyl-3-dimethylaminoacrylic Acid Methyl Ester

Sign In for Pricing
View Details
FPDT
HY-147789 1 Each

FPDT

Sign In for Pricing
View Details
Mouse IgG2b Goat Polyclonal Antibody
AP05386AP-N 1 mL

Mouse IgG2b Goat Polyclonal Antibody

Sign In for Pricing
View Details