Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Medium-wave-sensitive opsin 1 (Opn1mw)

This Recombinant Mouse Medium-wave-sensitive opsin 1 (Opn1mw) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 1, Green cone photoreceptor pigment, Green-sensitive opsin, M opsin, Medium wavelength-sensitive cone opsin

UniProt

O35599

Expression Region

1-359

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQRLTGEQTLDHYEDSTHASIFTYTNSNSTKGPFEGPNYHIAPRWVYHLTSTWMILVVV ASVFTNGLVLAATMRFKKLRHPLNWILVNLAVADLAETIIASTISVVNQIYGYFVLGHPL CVIEGYIVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLATVGIVFSWVWAAIWTA PPIFGWSRYWPYGLKTSCGPDVFSGTSYPGVQSYMMVLMVTCCIFPLSIIVLCYLQVWLA IRAVAKQQKESESTQKAEKEVTRMVVVMVFAYCLCWGPYTFFACFATAHPGYAFHPLVAS LPSYFAKSATIYNPIIYVFMNRQFRNCILHLFGKKVDDSSELSSTSKTEVSSVSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r93 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3018606 1.0 µg DNA

Vmn1r93 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Gpr44 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6745302 1.0 µg DNA

Gpr44 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Ttf2 Mouse shRNA Lentiviral Particle (Locus ID 74044)
TL504890V 500 µL Each

Ttf2 Mouse shRNA Lentiviral Particle (Locus ID 74044)

Sign In for Pricing
View Details
Recombinant Human SOD2/Mn-SOD (C-6His, Human Cells)
32-7813-50 50 µg

Recombinant Human SOD2/Mn-SOD (C-6His, Human Cells)

Sign In for Pricing
View Details
Fibroblast Growth Factor-Basic Human Recombinant
rAP-2203 1 Each

Fibroblast Growth Factor-Basic Human Recombinant

Sign In for Pricing
View Details
Rabbit Anti-AIF-M1/AIFM1 Polyclonal Antibody
PAV4761 100 μL

Rabbit Anti-AIF-M1/AIFM1 Polyclonal Antibody

Sign In for Pricing
View Details