Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SOD2/Mn-SOD (C-6His, Human Cells)

Source: Human Cells. MW :23.24kD. Recombinant Human SOD2 is produced by our Mammalian expression system and the target gene encoding Lys25-Lys222 is expressed with a 6His tag at the C-terminus. Superoxide Dismutase (SOD2) belongs to the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial matrix protein that forms a homotetramer and binds one manganese ion per subunit. SOD2 transforms toxic superoxide, a byproduct of the mitochondrial electron transport chain into hydrogen peroxide and diatomic oxygen. It is reported that oxidative stress plays an essential role in the development of breast cancer, while SOD2 is one of the primary enzymes that directly convert potential harmful oxidizing species to harmless metabolites.

Product Specifications

Gene Name

SOD2

Gene ID

6648

UniProt

P04179

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKKVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal CNTFR antibody - C-terminal region
APG03229G 0.05mg

Polyclonal CNTFR antibody - C-terminal region

Sign In for Pricing
View Details
Recombinant Human CA4 Protein, N-His
E55P1384 50 µg

Recombinant Human CA4 Protein, N-His

Sign In for Pricing
View Details
SGCE (NM_001099401) Human Tagged ORF Clone
RC217105 10 µg

SGCE (NM_001099401) Human Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Foxe1 shRNA (UAS) - Lentiviral mouse Foxe1 shRNA (UAS, RFP) (100)
GTR15110640 1 Vial

Lentiviral mouse Foxe1 shRNA (UAS) - Lentiviral mouse Foxe1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Zan ORF Vector (Mouse) (pORF)
ORF062046 1.0 µg DNA

Zan ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Escherichia coli O8 Glyoxylate/hydroxypyruvate reductase A (ghrA)
MBS1055549-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O8 Glyoxylate/hydroxypyruvate reductase A (ghrA)

Sign In for Pricing
View Details