Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Blue-sensitive opsin

This Recombinant Chicken Blue-sensitive opsin spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Blue-sensitive opsin, Blue cone photoreceptor pigment

UniProt

P28682

Expression Region

1-361

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHPPRPTTDLPEDFYIPMALDAPNITALSPFLVPQTHLGSPGLFRAMAAFMFLLIALGVP INTLTIFCTARFRKLRSHLNYILVNLALANLLVILVGSTTACYSFSQMYFALGPTACKIE GFAATLGGMVSLWSLAVVAFERFLVICKPLGNFTFRGSHAVLGCVATWVLGFVASAPPLF GWSRYIPEGLQCSCGPDWYTTDNKWHNESYVLFLFTFCFGVPLAIIVFSYGRLLITLRAV ARQQEQSATTQKADREVTKMVVVMVLGFLVCWAPYTAFALWVVTHRGRSFEVGLASIPSV FSKSSTVYNPVIYVLMNKQFRSCMLKLLFCGRSPFGDDEDVSGSSQATQVSSVSSSHVAP A

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pridopidine (hydrochloride)
HY-111210 1 Each

Pridopidine (hydrochloride)

Sign In for Pricing
View Details
MtlD Antibody
orb822154 2 mg

MtlD Antibody

Sign In for Pricing
View Details
SDS-PAGE Gel Preparation Kit
BWR1029 1 Kit

SDS-PAGE Gel Preparation Kit

Sign In for Pricing
View Details
LRP, MVP (Lung Resistance-related Protein, Major Vault Protein, VAULT 1, VAULT1)
MBS631738-01 0.1 mg

LRP, MVP (Lung Resistance-related Protein, Major Vault Protein, VAULT 1, VAULT1)

Sign In for Pricing
View Details
LRP, MVP (Lung Resistance-related Protein, Major Vault Protein, VAULT 1, VAULT1)
MBS631738-02 5x 0.1 mg

LRP, MVP (Lung Resistance-related Protein, Major Vault Protein, VAULT 1, VAULT1)

Sign In for Pricing
View Details
Raptor Rabbit Polyclonal Antibody (RBITC)
orb1047642 100 µL

Raptor Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details