Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized ABC transporter permease MJ1507 (MJ1507)

This Recombinant Methanocaldococcus jannaschii Uncharacterized ABC transporter permease MJ1507 (MJ1507) spans the amino acid sequence from region 1-399.

Product Specifications

Product Name Alternative

Uncharacterized ABC transporter permease MJ1507

UniProt

Q58902

Expression Region

1-399

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKSMKVDDIITFAFKNIKQKRTQSLLTIIGIVIGVLAMVSLISLGYGVQNYIHEEMMKM GSNKITILPMKQFGVPPSHLFTKKEIKAIKNVKGVDTVMYGWYGGCEIEYNGEKKFVSYY YAIPSKLREVYKDSGYDIEEGRWLEDNDKYACVIGYGTAHNLFDREIKVGDVIKIKDKKF RVVGILKQIGNQQDDNSIILNIDVGEKLFGNEGKYNFISVTVKEGEDIEKVSEEIKKALK KSFGDEDFSVLTAEQLAKTVSSVLGVITIFVVGVAAISLLVGAVGISNTMHMSILERRKD IGILKALGAETTDILAIFVVESGFLGLFGGIVGLVLGILLAEVIEALAHKMGYLMVNAWI SWELIVGVLIFSFLVGVISGYFPARSGAKLNPIETLRGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cadherin P (MaxLight 550) discontinued
C0108-37K-ML550 100 µL

Cadherin P (MaxLight 550) discontinued

Sign In for Pricing
View Details
Anti-Fruit fly DLG Antibody-iFluor647 Conjugate
DZ01287-iFluor647 200 µL

Anti-Fruit fly DLG Antibody-iFluor647 Conjugate

Sign In for Pricing
View Details
RAB3GAP1 antibody
FNab07030 100 µg

RAB3GAP1 antibody

Sign In for Pricing
View Details
Prl3d1 Mouse shRNA Lentiviral Particle (Locus ID 18775)
TL509138V 500 µL Each

Prl3d1 Mouse shRNA Lentiviral Particle (Locus ID 18775)

Sign In for Pricing
View Details
Recombinant Streptococcus pyogenes M protein type 1 Protein, N-His-KSI
orb2962378-01 50 µg

Recombinant Streptococcus pyogenes M protein type 1 Protein, N-His-KSI

Sign In for Pricing
View Details
Recombinant Streptococcus pyogenes M protein type 1 Protein, N-His-KSI
orb2962378-02 100 µg

Recombinant Streptococcus pyogenes M protein type 1 Protein, N-His-KSI

Sign In for Pricing
View Details