Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Lipoteichoic acid synthase (ltaS)

This Recombinant Staphylococcus aureus Lipoteichoic acid synthase (ltaS) spans the amino acid sequence from region 218-646.

Product Specifications

Product Name Alternative

Lipoteichoic acid synthase, Cleaved into the following 2 chains:, 1. Glycerol phosphate lipoteichoic acid synthase, 2. LTA synthase, EC= 3. 2.7.8.-, Polyglycerol phosphate synthase

UniProt

Q7A6U1

Expression Region

218-646

Origin

Staphylococcus aureus (strain N315)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SEDDLTKVLNYTKQRQTEPNPEYYGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGKEQFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQ KQGYKSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSAN YQAKMKSPFYSHLITLTNHYPFTLDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYIN DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSG GINNEYAGQVDVMPTILHLAGIDTKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNG KIYSNKNNELITTQPADFEKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYE TGPKANSKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CHRM2 Antibody
M02733-80ul 80 µL

Anti-CHRM2 Antibody

Sign In for Pricing
View Details
Rbx2 (G-8) Alexa Fluor® 546
sc-166554 AF546 200 µg/mL

Rbx2 (G-8) Alexa Fluor® 546

Sign In for Pricing
View Details
OR5T1 (NM_001004745) Human Tagged ORF Clone Lentiviral Particle
RC223026L4V 200 µL

OR5T1 (NM_001004745) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
3-[4- (pyridin-2-yl) piperazin-1-yl]propanoic acid dihydrochloride
sc-345979 250 mg

3-[4- (pyridin-2-yl) piperazin-1-yl]propanoic acid dihydrochloride

Sign In for Pricing
View Details
MKI67IP Antibody (Phospho-Thr234) : FITC (OAAF00251-FITC)
OAAF00251-100UG-FITC 100 µg

MKI67IP Antibody (Phospho-Thr234) : FITC (OAAF00251-FITC)

Sign In for Pricing
View Details
Conventional Kit Goat-anti-Mouse IgM (µ-chain) 25 nm gold
725.033 1 Kit

Conventional Kit Goat-anti-Mouse IgM (µ-chain) 25 nm gold

Sign In for Pricing
View Details