Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Paracoccus denitrificans Heme exporter protein B (ccmB)

This Recombinant Paracoccus denitrificans Heme exporter protein B (ccmB) spans the amino acid sequence from region 1-218.

Product Specifications

Product Name Alternative

Heme exporter protein B, Cytochrome c-type biogenesis protein CcmB

UniProt

P52219

Expression Region

1-218

Origin

Paracoccus denitrificans (strain Pd 1222)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKALLIRDLRLATRAGGGFGLALAFFLIVCTLVPFGVGPEGGTLSRIAPGILWVGALLSC LLSLDRIFALDFEDGSLDLLATAPLPLEGAVAIKALAHWLVTGLPLALSAPVFGLLLHLP GPAYPWLVASLLLGTPALSMLGAFGAAVTVGLRRGGLLLSLLVLPLYVPTLIFGAEAVRR GAAGADPMTALVFLAAITLATLALAPFAAAAALRVNLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AICAR (phosphate) (Standard)
HY-13417AR-01 5 mg

AICAR (phosphate) (Standard)

Sign In for Pricing
View Details
AICAR (phosphate) (Standard)
HY-13417AR-02 10 mg

AICAR (phosphate) (Standard)

Sign In for Pricing
View Details
AICAR (phosphate) (Standard)
HY-13417AR-03 25 mg

AICAR (phosphate) (Standard)

Sign In for Pricing
View Details
AICAR (phosphate) (Standard)
HY-13417AR-04 50 mg

AICAR (phosphate) (Standard)

Sign In for Pricing
View Details
AICAR (phosphate) (Standard)
HY-13417AR-05 100 mg

AICAR (phosphate) (Standard)

Sign In for Pricing
View Details
TCEA1P3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2346308 1.0 µg DNA

TCEA1P3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details