Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Protein translocase subunit SecF (secF)

This Recombinant Synechocystis sp. Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

Q55611

Expression Region

1-315

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLDLFKWEKPAWIVSSLLVLISIFAMAISWAQFQAPFRPGLDFVGGTRLQLQLECASSN NCPAAIDVAEVQDILGGVGLGNSSVQVIEDYTLSIRQQTLDVEQREAVQKALNEGIGKFD PETIQIDTVGPTVGKALFRSGVLALVISLLGIIIYLTIRFQLDYAVFAIIALLYDALITM GAFAIFGLVGGVEVDSLFLVALLTIIGFSVNDTVVIYDRVRETLERHSDWDINHVVDDAV NQTLTRSINTSLTTSLPLVAIFLFGGDSLKFFALALIIGFASGVYSSIFMATTLWAWWRK WRSPKNPPREMVAEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARPC2 (NM_152862) Human Tagged Lenti ORF Clone
RC223208L4 10 µg

ARPC2 (NM_152862) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CD16 Antibody [CB16] (FITC)
76-570 100 Tests

CD16 Antibody [CB16] (FITC)

Sign In for Pricing
View Details
RMND1 Double Nickase Plasmid (h)
sc-409984-NIC 20 µg

RMND1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Pig Endothelin1 (ET-1) ELISA Kit
orb781270-01 48 Tests

Pig Endothelin1 (ET-1) ELISA Kit

Sign In for Pricing
View Details
Pig Endothelin1 (ET-1) ELISA Kit
orb781270-02 96 Tests

Pig Endothelin1 (ET-1) ELISA Kit

Sign In for Pricing
View Details
Nori® Hamster FGF13 ELISA Kit
GR172123 96 Well

Nori® Hamster FGF13 ELISA Kit

Sign In for Pricing
View Details