Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 236 (TMEM236)

This Recombinant Human Transmembrane protein 236 (TMEM236) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Transmembrane protein 236

UniProt

Q5W0B7

Expression Region

1-351

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASGRLIKFVVFELLEFAAFSIPTLVITEQFATAYQGTRARSDNTHYWLIISCSIAYVAL VTLLIWVPVKVILHKKRYIYRKIKGWRPVLMMCVVLTTLPCLTFSIAVTEVQKSINGSAD VLPDMLPDLPVSLVLLSLIMVDIIEKLRIYPLRGSQKSSENGHIHSTSLQHIKTVTEQVR QSPENAASPQATNSTQVSQPSGAMTRSQESVFMGPQEPSCDSGILRMMSRRDVRAELFLW SFLLWSDTIEMVRVAGHPNVYKSSWLYPVYIFSFISLLRITFTPQNPLLNSLSVLLQDLP FVFVRLGLIIALGTITPVLGLCKNILVTLSYIYFNYLTRIRIFSAFEMSPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 (EndoCAM, PECA1, Platelet Endothelial Cell Adhesion Molecule 1, GPIIA', PECAM-1) (PE)
172045-AF-PE 100 µL

CD31 (EndoCAM, PECA1, Platelet Endothelial Cell Adhesion Molecule 1, GPIIA', PECAM-1) (PE)

Sign In for Pricing
View Details
Recombinant Uroplakin 1B Antibody / UPK1B
V5386-20UG 20 µg

Recombinant Uroplakin 1B Antibody / UPK1B

Sign In for Pricing
View Details
Recombinant Schizophyllum commune Mating-type protein A-alpha Z3, partial
MBS1129320 Inquire

Recombinant Schizophyllum commune Mating-type protein A-alpha Z3, partial

Sign In for Pricing
View Details
Rabbit Monoclonal CXADR Antibody Pair [HRP]
NBP2-79296-15Plates 15 Plates

Rabbit Monoclonal CXADR Antibody Pair [HRP]

Sign In for Pricing
View Details
AEN Adenovirus (Mouse)
11461055 1.0 mL

AEN Adenovirus (Mouse)

Sign In for Pricing
View Details
NFE2L1 antibody - middle region
MBS3203989-01 0.1 mL

NFE2L1 antibody - middle region

Sign In for Pricing
View Details