Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori Protein translocase subunit SecD (secD)

This Recombinant Helicobacter pylori Protein translocase subunit SecD (secD) spans the amino acid sequence from region 1-525.

Product Specifications

Product Name Alternative

Protein translocase subunit SecD

UniProt

O26074

Expression Region

1-525

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLFNARLIVFIGALLLGVGFSVPSLLETKGPKITLGLDLRGGLNMLLGVQTDEALKNKY LSLASALEYNAKKQNILLKDIKSNLEGISFELLDEDEAKKLDALLLELQGHSQFEIKKEA GFYSVNLTPLEQEELRKNTILQVIGIIRNRLDQFGLAEPVVIQQGKEEISVQLPGIKTLE EERRAKDLISRSAHLQMMAVDEEHNKDAMKMTDLEAQKLGSVLLSDVEMGGKILLKAIPI LDGEMLTDAKVVYDQNNQPVVSFTLDAQGAKIFGDFSGANVGKRMAIVLDNKVYSAPVIR ERIGGGSGQISGNFSVAQASDLAIALRSGAMSAPIQVLEKRIIGPSLGKDSVKTSIIALV GGFILVMGFMVLYYSMAGVIACLALVVNLFLIVAVMAIFGATLTLPGMAGIVLTVGIAVD ANIIINERIREVLRENEGIAKAIHLGYINASRAIFDSNITSLIASVLLYAYGTGAIKGFA LTTGIGILASIITAIVGTQGIYQALLPKLTQTKSLYFWFGVNKRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF4, Phosphorylated (pS245) (Tax-responsive enhancer element B67, ATF4 protein) (MaxLight 490)
MBS6275881-01 0.1 mL

ATF4, Phosphorylated (pS245) (Tax-responsive enhancer element B67, ATF4 protein) (MaxLight 490)

Sign In for Pricing
View Details
ATF4, Phosphorylated (pS245) (Tax-responsive enhancer element B67, ATF4 protein) (MaxLight 490)
MBS6275881-02 5x 0.1 mL

ATF4, Phosphorylated (pS245) (Tax-responsive enhancer element B67, ATF4 protein) (MaxLight 490)

Sign In for Pricing
View Details
NLRC4
CSB-CL873615HU 10 μg Plasmid + 200 μL Glycerol

NLRC4

Sign In for Pricing
View Details
CD200R1 (Cell Surface Glycoprotein CD200 Receptor 1, CD200 Cell Surface Glycoprotein Receptor, Cell Surface Glycoprotein OX2 Receptor 1, CD200R, CRTR2, MOX2R, OX2R, UNQ2522/PRO6015) (AP) discontinued
124571-AP 100 µL

CD200R1 (Cell Surface Glycoprotein CD200 Receptor 1, CD200 Cell Surface Glycoprotein Receptor, Cell Surface Glycoprotein OX2 Receptor 1, CD200R, CRTR2, MOX2R, OX2R, UNQ2522/PRO6015) (AP) discontinued

Sign In for Pricing
View Details
C13orf15 CRISPR All-in-one AAV vector set (with saCas9)(Human)
53581151 3x 1.0 µg DNA

C13orf15 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Stem cell factor, Human, Purified Recombinant Protein
PE-1242-2 2 µg

Stem cell factor, Human, Purified Recombinant Protein

Sign In for Pricing
View Details