Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

O52366

Expression Region

1-288

Origin

Providencia stuartii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGSMALSKWHAYSRLMRIDRPIGSLLLLWPTYWALWIAAQSIPSLHILIVFTAGVFLMR AAGCVINDFADRHFDGHVERTKHRPLPSGDVTEKEAKILFASLVGLSFLLVLTLNSMTIW LSVAGLALAWIYPFVKRVSHLLQVVLGAAFGWSIPMGFSAVSESLPLVCWVLFLVNILWS VIYDTQYAMVDRNDDLKIGVKSTAILFGQYDKLIIGILQIVMIVLLVLVGSLADLGAVYY IALSLSALLFIYQQKLMVDRERAPCFKAFLNNNYVGLILFIGIFLSYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-GPRC6A Antibody
YLD3613-01 50 µL

Rabbit anti-GPRC6A Antibody

Sign In for Pricing
View Details
Rabbit anti-GPRC6A Antibody
YLD3613-02 100 µL

Rabbit anti-GPRC6A Antibody

Sign In for Pricing
View Details
P40/RABEPK Rabbit Polyclonal Antibody (Cy5)
orb962687 100 µL

P40/RABEPK Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Lentiviral human AKR1A1 sgRNA gene knockout kit - Lentiviral human AKR1A1 sgRNA gene knockout kit (25)
GTR15373239 1 Vial

Lentiviral human AKR1A1 sgRNA gene knockout kit - Lentiviral human AKR1A1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
PTDSS1 Antibody (C-term)
orb1926228-01 50 µL

PTDSS1 Antibody (C-term)

Sign In for Pricing
View Details
PTDSS1 Antibody (C-term)
orb1926228-02 100 µL

PTDSS1 Antibody (C-term)

Sign In for Pricing
View Details