Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

O52366

Expression Region

1-288

Origin

Providencia stuartii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGSMALSKWHAYSRLMRIDRPIGSLLLLWPTYWALWIAAQSIPSLHILIVFTAGVFLMR AAGCVINDFADRHFDGHVERTKHRPLPSGDVTEKEAKILFASLVGLSFLLVLTLNSMTIW LSVAGLALAWIYPFVKRVSHLLQVVLGAAFGWSIPMGFSAVSESLPLVCWVLFLVNILWS VIYDTQYAMVDRNDDLKIGVKSTAILFGQYDKLIIGILQIVMIVLLVLVGSLADLGAVYY IALSLSALLFIYQQKLMVDRERAPCFKAFLNNNYVGLILFIGIFLSYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTR5B Adenovirus (Mouse)
24088054 1.0 mL

HTR5B Adenovirus (Mouse)

Sign In for Pricing
View Details
Galk1 Mouse qPCR Template Standard (NM_016905)
MK201433 1 Kit

Galk1 Mouse qPCR Template Standard (NM_016905)

Sign In for Pricing
View Details
MRPL23-AS1 ORF Vector (Human) (pORF)
30458011 1.0 µg DNA

MRPL23-AS1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human Epidermal growth factor receptor ELISA Kit
orb1661034 96 Tests

Human Epidermal growth factor receptor ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal GEMIN2 Antibody (9C8K3)
NBP3-15717-20ul 20 µL

Rabbit Monoclonal GEMIN2 Antibody (9C8K3)

Sign In for Pricing
View Details
Dusp19 Peptide - N-terminal region
orb2010932 100 µg

Dusp19 Peptide - N-terminal region

Sign In for Pricing
View Details