Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dusp19 Peptide - N-terminal region

Dusp19 Peptide - N-terminal region

Product Specifications

UniProt

D4A8F3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dusp19 Rabbit Polyclonal Antibody (orb581738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101209

Preservative

Lyophilized powder

AA Sequence

MHSLNQEIKAFSRDNLRKQCTRVTTLTGKKLIETWKDATVHVVETETSGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF124 Antibody
58-628 400 µL

ZNF124 Antibody

Sign In for Pricing
View Details
WLS Antibody
CSB-PA009786GA01HU 100 µL

WLS Antibody

Sign In for Pricing
View Details
Recombinant mouse C-X-C motif chemokine 3 protein
MBS717368-01 0.05 mg

Recombinant mouse C-X-C motif chemokine 3 protein

Sign In for Pricing
View Details
Recombinant mouse C-X-C motif chemokine 3 protein
MBS717368-02 0.2 mg

Recombinant mouse C-X-C motif chemokine 3 protein

Sign In for Pricing
View Details
Recombinant mouse C-X-C motif chemokine 3 protein
MBS717368-03 0.5 mg

Recombinant mouse C-X-C motif chemokine 3 protein

Sign In for Pricing
View Details
Recombinant mouse C-X-C motif chemokine 3 protein
MBS717368-04 1 mg

Recombinant mouse C-X-C motif chemokine 3 protein

Sign In for Pricing
View Details