Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-55 (srd-55)

This Recombinant Serpentine receptor class delta-55 (srd-55) spans the amino acid sequence from region 1-334.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-55, Protein srd-55

UniProt

Q09572

Expression Region

1-334

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSLSSNRIVPFVDIYFKIYFYGGLTFQLLLLTLILTKSPSILTNLKFFLINTCFLQIIL ISLGFFTQHRSLPNIDSFAVLPRGPCREFGPDVCFSAYHFFLGVALCVGLGISNTIIFRF QALRKGRVSRSRIFTMISLTYIPSSITIILPFTSSWDFEKVRSLTYIEHPKYDLSIYEPF VGFHNIASFQFTLATLLLVIGAYAIPAISGFLTSRVIHLINDNRGMSLKTKEQSKTLAYG LACQTFLPVICYIPVASCYIFSQMTSVELLLNEHLLGILICFPSFVDPFISFYFIVPYRQ ALLGLFKCRKTKPLNIVITVRHLSKRNPSIVDSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human INPP5A Protein (His Tag)
PKSH033170-01 10 µg

Recombinant Human INPP5A Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human INPP5A Protein (His Tag)
PKSH033170-02 50 µg

Recombinant Human INPP5A Protein (His Tag)

Sign In for Pricing
View Details
OR6K3 (NM_001005327) Human Over-expression Lysate
LC423855 20 µg

OR6K3 (NM_001005327) Human Over-expression Lysate

Sign In for Pricing
View Details
NOTCH2 (Cleaved-Val1697) Antibody
8L0353-AAT 50 µg

NOTCH2 (Cleaved-Val1697) Antibody

Sign In for Pricing
View Details
Phenyl 4-Bromo-2-cyclopropylpyridine-1(2H)-carboxylate
TRC-P336720-250MG 250 mg

Phenyl 4-Bromo-2-cyclopropylpyridine-1(2H)-carboxylate

Sign In for Pricing
View Details
MIR302f Human qPCR Primer Pair (MI0006418)
HP300293 200 Reactions

MIR302f Human qPCR Primer Pair (MI0006418)

Sign In for Pricing
View Details