Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mannose permease IIC component (manY)

This Recombinant Mannose permease IIC component (manY) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Mannose permease IIC component, EII-P-Man, EIIC-Man, PTS system mannose-specific EIIC component

UniProt

P69802

Expression Region

1-266

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEITTLQIVLVFIVACIAGMGSILDEFQFHRPLIACTLVGIVLGDMKTGIIIGGTLEMIA LGWMNIGAAVAPDAALASIISTILVIAGHQSIGAGIALAIPLAAAGQVLTIIVRTITVAF QHAADKAADNGNLTAISWIHVSSLFLQAMRVAIPAVIVALSVGTSEVQNMLNAIPEVVTN GLNIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVTAAFTNFNLVALGVIGTVMAVLYIQ LSPKYNRVAGAPAQAAGNNDLDNELD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS25P4 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV784228 1.0 µg DNA

RPS25P4 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Renin (REN) Magnetic Fluorescence Assay Kit
MBS2156591-01 96 Tests

Renin (REN) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Renin (REN) Magnetic Fluorescence Assay Kit
MBS2156591-02 5x 96 Tests

Renin (REN) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Renin (REN) Magnetic Fluorescence Assay Kit
MBS2156591-03 10x 96 Tests

Renin (REN) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Recombinant Sars-Cov-2 (COVID-19/2019-nCov) Spike RBD Protein
MBS669401-01 0.1 mg

Recombinant Sars-Cov-2 (COVID-19/2019-nCov) Spike RBD Protein

Sign In for Pricing
View Details
Recombinant Sars-Cov-2 (COVID-19/2019-nCov) Spike RBD Protein
MBS669401-02 5x 0.1 mg

Recombinant Sars-Cov-2 (COVID-19/2019-nCov) Spike RBD Protein

Sign In for Pricing
View Details