Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Somatostatin receptor type 5 (Sstr5)

This Recombinant Mouse Somatostatin receptor type 5 (Sstr5) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

Somatostatin receptor type 5, SS-5-R, SS5-R, SS5R

UniProt

O08858

Expression Region

1-362

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPLSLTSTPSWNASAASSSSHNWSLVDPVSPMGARAVLVPVLYLLVCTVGLGGNTLVIY VVLRYAKMKTVTNVYILNLAVADVLFMLGLPFLATQNAVSYWPFGSFLCRLVMTLDGINQ FTSIFCLMVMSVDRYLAVVHPLRSARWRRPRVAKLASAAVWVFSLLMSLPLLVFADVQEG WGTCNLSWPEPVGLWGAAFITYTSVLGFFGPLLVICLCYLLIVVKVKAAGMRVGSSRRRR SERKVTRMVVVVVLVFVGCWLPFFIVNIVNLAFTLPEEPTSAGLYFFVVVLSYANSCANP LLYGFLSDNFRQSFRKALCLRRGYGVEDADAIEPRPDKSGRPQTTLPTRSCEANGLMQTS RL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANT1/ANT2/ANT3/ANT4 Rabbit pAb (APR22580N)
APR22580N-01 50 µL

ANT1/ANT2/ANT3/ANT4 Rabbit pAb (APR22580N)

Sign In for Pricing
View Details
ANT1/ANT2/ANT3/ANT4 Rabbit pAb (APR22580N)
APR22580N-02 100 µL

ANT1/ANT2/ANT3/ANT4 Rabbit pAb (APR22580N)

Sign In for Pricing
View Details
ANT1/ANT2/ANT3/ANT4 Rabbit pAb (APR22580N)
APR22580N-03 200 µL

ANT1/ANT2/ANT3/ANT4 Rabbit pAb (APR22580N)

Sign In for Pricing
View Details
Rabbit Polyclonal DOCK11 Antibody [DyLight 488]
NB100-81662G 0.1 mL

Rabbit Polyclonal DOCK11 Antibody [DyLight 488]

Sign In for Pricing
View Details
ZNF484, NT (ZNF484, Zinc finger protein 484) (MaxLight 550)
MBS6366719-01 0.1 mL

ZNF484, NT (ZNF484, Zinc finger protein 484) (MaxLight 550)

Sign In for Pricing
View Details
ZNF484, NT (ZNF484, Zinc finger protein 484) (MaxLight 550)
MBS6366719-02 5x 0.1 mL

ZNF484, NT (ZNF484, Zinc finger protein 484) (MaxLight 550)

Sign In for Pricing
View Details