Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANT1/ANT2/ANT3/ANT4 Rabbit pAb (APR22580N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ANT1/ANT2/ANT3/ANT4 Rabbit pAb (APR22571N8) .

Synonyms

ANT1/ANT2/ANT3/ANT4

Gene ID

291/292/293/83447

UniProt

P12235/P05141/P12236/Q9H0C2

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 33kDa/32kDa/35kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=291/292/293/83447

Uniprot URL

https://www.uniprot.org/uniprot/P12235/P05141/P12236/Q9H0C2

AA Sequence

GMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aeromonas Hydrophila glmU Protein
VAng-Lsx1028-500gEcoli 500 µg (E. coli)

Recombinant Aeromonas Hydrophila glmU Protein

Sign In for Pricing
View Details
EBF1 (COE1, Early B Cell factor 1, COE1, EBF, O/E-1, OLF1, Collier, Olf and EBF transcription factor 1, early B Cell factor olfactory neuronal transcription factor 1) (Biotin)
MBS6141652-01 0.1 mL

EBF1 (COE1, Early B Cell factor 1, COE1, EBF, O/E-1, OLF1, Collier, Olf and EBF transcription factor 1, early B Cell factor olfactory neuronal transcription factor 1) (Biotin)

Sign In for Pricing
View Details
EBF1 (COE1, Early B Cell factor 1, COE1, EBF, O/E-1, OLF1, Collier, Olf and EBF transcription factor 1, early B Cell factor olfactory neuronal transcription factor 1) (Biotin)
MBS6141652-02 5x 0.1 mL

EBF1 (COE1, Early B Cell factor 1, COE1, EBF, O/E-1, OLF1, Collier, Olf and EBF transcription factor 1, early B Cell factor olfactory neuronal transcription factor 1) (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to TLL1
MBS8537209-01 0.1 mL

Mouse Monoclonal Antibody to TLL1

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to TLL1
MBS8537209-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to TLL1

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to TLL1
MBS8537209-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to TLL1

Sign In for Pricing
View Details