Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Long-wave-sensitive opsin 1 (OPN1LW)

This Recombinant Cat Long-wave-sensitive opsin 1 (OPN1LW) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Long-wave-sensitive opsin 1, Red cone photoreceptor pigment, Red-sensitive opsin

UniProt

O18913

Expression Region

1-364

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQRWGPQRLAGGQPHAGLEDSTRASIFTYTNSNATRGPFEGPNYHIAPRWVYHVTSAWM IFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETIIASTISVVNQIYGYFV LGHPMCVLEGYTVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLAIAGIAFSWIWA AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMITCCIIPLSVIVLCYL QVWLAIRAVAKQQKESESTQKAEKEVTRMVMVMIFAYCVCWGPYTFFACFAAAHPGYAFH PLVAALPAYFAKSATIYNPIIYVFMNRQFRNCIMQLFGKKVDDGSELSSASRTEASSVSS VSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3orf84 (NM_001080528) Human Over-expression Lysate
LC421083 20 µg

C3orf84 (NM_001080528) Human Over-expression Lysate

Sign In for Pricing
View Details
Amplite® Colorimetric Superoxide Dismutase (SOD) Assay Kit *Enhanced Sensitivity*
11308-AAT 200 Tests

Amplite® Colorimetric Superoxide Dismutase (SOD) Assay Kit *Enhanced Sensitivity*

Sign In for Pricing
View Details
Recombinant Human NRCAM Protein (Fc Tag)
PKSH033581-01 10 µg

Recombinant Human NRCAM Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human NRCAM Protein (Fc Tag)
PKSH033581-02 50 µg

Recombinant Human NRCAM Protein (Fc Tag)

Sign In for Pricing
View Details
Cdk4 Recombinant Rabbit Monoclonal Antibody [SD205-1]
ET1612-23 100 µL

Cdk4 Recombinant Rabbit Monoclonal Antibody [SD205-1]

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/3142R), CF568 conjugate, 0.1mg/mL
BNC683142-100 1x 100 µL

Spectrin beta III (SPTBN2) (SPTBN2/3142R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details