Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukotriene B4 receptor 2 (LTB4R2)

This Recombinant Human Leukotriene B4 receptor 2 (LTB4R2) spans the amino acid sequence from region 1-389.

Product Specifications

Product Name Alternative

Leukotriene B4 receptor 2, LTB4-R 2, LTB4-R2, LTB4 receptor JULF2, Leukotriene B4 receptor BLT2, Seven transmembrane receptor BLTR2

UniProt

Q9NPC1

Expression Region

1-389

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSRATGTAFLLL AALLGLPGNGFVVWSLAGWRPARGRPLAATLVLHLALADGAVLLLTPLFVAFLTRQAWPL GQAGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAA LLLAVPAAVYRHLWRDRVCQLCHPSPVHAAAHLSLETLTAFVLPFGLMLGCYSVTLARLR GARWGSGRHGARVGRLVSAIVLAFGLLWAPYHAVNLLQAVAALAPPEGALAKLGGAGQAA RAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRT TPQLKVVGQGRGNGDPGGGMEKDGPEWDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 6 (IL-6), recombinant (Human)
033-31 10 µg

Interleukin 6 (IL-6), recombinant (Human)

Sign In for Pricing
View Details
CALCR Polyclonal Antibody
ABP57965-01 30 µL

CALCR Polyclonal Antibody

Sign In for Pricing
View Details
CALCR Polyclonal Antibody
ABP57965-02 100 µL

CALCR Polyclonal Antibody

Sign In for Pricing
View Details
CALCR Polyclonal Antibody
ABP57965-03 200 µL

CALCR Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Zbtb33 shRNA (UAS) - Lentiviral mouse Zbtb33 shRNA (UAS, RFP) (100)
GTR15233628 1 Vial

Lentiviral mouse Zbtb33 shRNA (UAS) - Lentiviral mouse Zbtb33 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant Listeria innocua serovar 6a Putative N-acetylmannosamine-6-phosphate 2-epimerase (nanE)
MBS1320497-01 0.02 mg (E-Coli)

Recombinant Listeria innocua serovar 6a Putative N-acetylmannosamine-6-phosphate 2-epimerase (nanE)

Sign In for Pricing
View Details