Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 182 (Gpr182)

This Recombinant Mouse G-protein coupled receptor 182 (Gpr182) spans the amino acid sequence from region 1-395.

Product Specifications

Product Name Alternative

G-protein coupled receptor 182, G10D, NOW

UniProt

P43142

Expression Region

1-395

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVIPSPRPVSTLEPDNDFRDIHNWTELLHLFNQTFTDCHIEFNENTKHVVLFVFYLAIF VVGLVENVLVICVNCRRSGRVGMLNLYILNMAIADLGIILSLPVWMLEVMLEYTWLWGSF SCRFIHYFYLVNMYSSIFFLTCLSIDRYVTLTNTSPSWQRHQHRIRRAVCAGVWVLSAII PLPEVVHIQLLDGSEPMCLFLAPFETYSAWALAVALSATILGFLLPFLLIAVFNILTACR LRRQRQTESRRHCLLMWAYIVVFAICWLPYQVTMLLLTLHGTHIFLHCHLVNLLYFFYEI IDCFSMLHCVANPILYNFLSPSFRGRLLSLVVRYLPKEQARAAGGRASSSSSTQHSIIIT KEGSLPLQRISTPTPSETFRRPLRLQTPHLHSAIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Srrm4 shRNA (UAS) - Lentiviral mouse Srrm4 shRNA (UAS, RFP) plasmid
GTR15149197 1 Vial

Lentiviral mouse Srrm4 shRNA (UAS) - Lentiviral mouse Srrm4 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal Hematopoietic Prostaglandin D Synthase/HPGDS Antibody [Alexa Fluor 488]
NBP2-97023AF488 0.1 mL

Rabbit Polyclonal Hematopoietic Prostaglandin D Synthase/HPGDS Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 beta (CCL19) Human qPCR Template Standard (NM_006274)
HK201740 1 Kit

Macrophage Inflammatory Protein 3 beta (CCL19) Human qPCR Template Standard (NM_006274)

Sign In for Pricing
View Details
FADD polyclonal antibody
BZ16883-01 50 µL

FADD polyclonal antibody

Sign In for Pricing
View Details
FADD polyclonal antibody
BZ16883-02 100 µL

FADD polyclonal antibody

Sign In for Pricing
View Details
FAM167A Polyclonal Antibody, Biotin Conjugated
A66465-050 50 µL

FAM167A Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details