Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Beta-2 adrenergic receptor (ADRB2)

This Recombinant Dog Beta-2 adrenergic receptor (ADRB2) spans the amino acid sequence from region 1-415.

Product Specifications

Product Name Alternative

Beta-2 adrenergic receptor, Beta-2 adrenoreceptor, Beta-2 adrenoceptor

UniProt

P54833

Expression Region

1-415

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQPANRSVFLLAPNGSHAPDQGDSQERSEAWVVGMGIVMSLIVLAIVFGNVLVITAIAR FERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWTFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYFAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHQE AINCYAKETCCDFFTNQAYAIASSIVSFYLPLVVMVFVYSRVFQVAQRQLQKIDRSEGRF HAQNLSQVEQDGRSGHGHRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD NLIPKEVYILLNWVGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSNNSNS RSDYAGEHSGCHLGQEKDSELLCEDPPGTEDRQGTVPSDSVDSQGRNCSTNDSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GM CSF Receptor alpha (CSF2RA) Rabbit Polyclonal Antibody
TA375136 100 µL

GM CSF Receptor alpha (CSF2RA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLFNL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F7]
TA501885BM 100 µL

SLFNL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F7]

Sign In for Pricing
View Details
FTCD Antibody
KC-815-01 50 μL

FTCD Antibody

Sign In for Pricing
View Details
FTCD Antibody
KC-815-02 100 µL

FTCD Antibody

Sign In for Pricing
View Details
FTCD Antibody
KC-815-03 1 mL

FTCD Antibody

Sign In for Pricing
View Details
PAK1 Antibody Polyclonal Antibody
AN100004P 100 µL

PAK1 Antibody Polyclonal Antibody

Sign In for Pricing
View Details