Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat 5-hydroxytryptamine receptor 6 (Htr6)

This Recombinant Rat 5-hydroxytryptamine receptor 6 (Htr6) spans the amino acid sequence from region 1-436.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 6, 5-HT-6, 5-HT6, ST-B17, Serotonin receptor 6

UniProt

P31388

Expression Region

1-436

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIVLICTQPALRNT SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTPAPGQC RLLASLPFVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTAGQALETLQVP RTPRPGMESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIAQAVCDCISPG LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCVHCPPEHRPALPPPPCGPLTAVP DQASACSRCCLCLCRQTQIQTPLQGAPRACSSQPSFCCLERPPGTPRHPPGPPLWSTSLS QTLWSLRYGRIHSVPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human WNT16 Protein, N-GST
orb2967188-01 50 µg

Recombinant Human WNT16 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human WNT16 Protein, N-GST
orb2967188-02 100 µg

Recombinant Human WNT16 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human WNT16 Protein, N-GST
orb2967188-03 1 mg

Recombinant Human WNT16 Protein, N-GST

Sign In for Pricing
View Details
Mafg (BC002092) Mouse Tagged ORF Clone
MG201268 10 µg

Mafg (BC002092) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human Transforming Growth Factor β2
B2010334 10 µg

Human Transforming Growth Factor β2

Sign In for Pricing
View Details
EMD siRNA Oligos set (Human)
19251171 3x 5 nmol

EMD siRNA Oligos set (Human)

Sign In for Pricing
View Details