Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 5-hydroxytryptamine receptor 6 (Htr6)

This Recombinant Mouse 5-hydroxytryptamine receptor 6 (Htr6) spans the amino acid sequence from region 1-440.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 6, 5-HT-6, 5-HT6, Serotonin receptor 6

UniProt

Q9R1C8

Expression Region

1-440

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIALICTQPALRNT SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTSAPGQC RLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTATAGQALETLQ VPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFFVTWLPFFVASIAQAVCDCIS PGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCVHCPPEHRASPASPSMWTSHS GARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLLLPGEATRDPPPPTRAPTVVNF FVTDSVEPEIRQHPLGSPMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse BDNF (Brain Derived Neurotrophic Factor) ELISA Kit
E-EL-M0203-01 24 Tests

Mouse BDNF (Brain Derived Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Mouse BDNF (Brain Derived Neurotrophic Factor) ELISA Kit
E-EL-M0203-02 48 Tests

Mouse BDNF (Brain Derived Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Mouse BDNF (Brain Derived Neurotrophic Factor) ELISA Kit
E-EL-M0203-03 96 Tests

Mouse BDNF (Brain Derived Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504131 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Human Neuronal Pentraxin Receptor (NPTXR) ELISA Kit
RDR-NPTXR-Hu-01 96 Tests

Human Neuronal Pentraxin Receptor (NPTXR) ELISA Kit

Sign In for Pricing
View Details
Human Neuronal Pentraxin Receptor (NPTXR) ELISA Kit
RDR-NPTXR-Hu-02 48 Tests

Human Neuronal Pentraxin Receptor (NPTXR) ELISA Kit

Sign In for Pricing
View Details