Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-hydroxytryptamine receptor 6 (HTR6)

This Recombinant Human 5-hydroxytryptamine receptor 6 (HTR6) spans the amino acid sequence from region 1-440.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 6, 5-HT-6, 5-HT6, Serotonin receptor 6

UniProt

P50406

Expression Region

1-440

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF FNIDPAEPELRPHPLGIPTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CHI3L1/YKL40 Protein (His Tag)
PKSH033717-01 10 µg

Recombinant Human CHI3L1/YKL40 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CHI3L1/YKL40 Protein (His Tag)
PKSH033717-02 50 µg

Recombinant Human CHI3L1/YKL40 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FSH Protein (Flag & His Tag)
PKSH032453-01 10 µg

Recombinant Human FSH Protein (Flag & His Tag)

Sign In for Pricing
View Details
Recombinant Human FSH Protein (Flag & His Tag)
PKSH032453-02 50 µg

Recombinant Human FSH Protein (Flag & His Tag)

Sign In for Pricing
View Details
CDK10 Rabbit Polyclonal Antibody
TA374548 100 µL

CDK10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF488A conjugate, 0.1mg/mL
BNC881747-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details