Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuropeptide Y receptor type 5 (NPY5R)

This Recombinant Human Neuropeptide Y receptor type 5 (NPY5R) spans the amino acid sequence from region 1-445.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 5, NPY5-R, NPY-Y5 receptor, NPYY5-R, Y5 receptor

UniProt

Q15761

Expression Region

1-445

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNL LILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFL QCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSL VELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC GLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIK KRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL NPILYGFLNNGIKADLVSLIHCLHM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amigo3 3'UTR Luciferase Stable Cell Line
TU101741 1.0 mL

Amigo3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lrit3 siRNA Oligos set (Mouse)
27600174 3x 5 nmol

Lrit3 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Recombinant Mouse PDGFA Protein, Untagged, E.coli-10ug
QP5462-10ug 10ug

Recombinant Mouse PDGFA Protein, Untagged, E.coli-10ug

Sign In for Pricing
View Details
Anti-Ms CD49e PE
1P-743-C100 0.1 mg

Anti-Ms CD49e PE

Sign In for Pricing
View Details
Recombinant Human BLMH Protein, N-His
bs-101962P-01 20 µg

Recombinant Human BLMH Protein, N-His

Sign In for Pricing
View Details
Recombinant Human BLMH Protein, N-His
bs-101962P-02 50 µg

Recombinant Human BLMH Protein, N-His

Sign In for Pricing
View Details