Recombinant Human CD99 antigen (CD99)
This Recombinant Human CD99 antigen (CD99) spans the amino acid sequence from region 23-185.
Product Specifications
Product Name Alternative
CD99 antigen, 12E7, E2 antigen, Protein MIC2, T-cell surface glycoprotein E2, CD_antigen= CD99
UniProt
P14209
Expression Region
23-185
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4519903 1.0 µg DNA
Pramef8 sgRNA CRISPR Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 