Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Kit ligand (KITLG)

This Recombinant Sheep Kit ligand (KITLG) spans the amino acid sequence from region 26-267.

Product Specifications

Product Name Alternative

Kit ligand, Mast cell growth factor, MGF, Stem cell factor, SCF, c-Kit ligand, Cleaved into the following chain:, 1. Soluble KIT ligand, 2. sKITLG

UniProt

P79368

Expression Region

26-267

Origin

Ovis aries (Sheep)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QGICRNRVTDDVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVEQLSVSLTDLL DKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSFENVKKSSKSPEPRQFTPEKFFGIFN KSIDAFKDLEIVASTMSECVISSTSSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKA SNSIEDSSLQWAAVALPAFFSLVIGFAFGALYWKKKQPNLTRTVENRQINEEDNEISMLQ EK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ML401
BA5310-25 25 mg

ML401

Sign In for Pricing
View Details
Canine Anti-thymocyte globulin (ATG) ELISA Kit
NSL1838Ca 96 Tests

Canine Anti-thymocyte globulin (ATG) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Protein SSX4 (SSX4)
RPC31549-01 20 µg

Recombinant Human Protein SSX4 (SSX4)

Sign In for Pricing
View Details
Recombinant Human Protein SSX4 (SSX4)
RPC31549-02 100 µg

Recombinant Human Protein SSX4 (SSX4)

Sign In for Pricing
View Details
Recombinant Human Protein SSX4 (SSX4)
RPC31549-03 1 mg

Recombinant Human Protein SSX4 (SSX4)

Sign In for Pricing
View Details
Anti-C3/Complement C3 (Recombinant Alpaca, Monoclonal, VHH-8His-Cys-tag)
A134127 100 µL

Anti-C3/Complement C3 (Recombinant Alpaca, Monoclonal, VHH-8His-Cys-tag)

Sign In for Pricing
View Details