Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SSX4 (SSX4)

Recombinant Human Protein SSX4 (SSX4) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Protein SSX4 (SSX4) . Accession Number: O60224; SSX4. Expression Region: 1-188aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 25.9kda. Target Synonyms: Cancer/testis antigen 5.4; CT5.4 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Protein SSX4 (SSX4) is a purified Recombinant Protein.

Accession Number

O60224; SSX4

Expression Region

1-188aa

Host

E. coli

Target

Protein SSX4 (SSX4)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

25.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cancer/testis antigen 5.4; CT5.4

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fbxo24 (NM_001107130) Rat Tagged ORF Clone Lentiviral Particle
RR202580L3V 200 µL

Fbxo24 (NM_001107130) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human AUNIP Protein
E30P8288 20 µg

Recombinant Human AUNIP Protein

Sign In for Pricing
View Details
FMDV Protease 3C Recombinant Protein (N-His)
VK500112-01 50 µg

FMDV Protease 3C Recombinant Protein (N-His)

Sign In for Pricing
View Details
FMDV Protease 3C Recombinant Protein (N-His)
VK500112-02 100 µg

FMDV Protease 3C Recombinant Protein (N-His)

Sign In for Pricing
View Details
FMDV Protease 3C Recombinant Protein (N-His)
VK500112-03 1 mg

FMDV Protease 3C Recombinant Protein (N-His)

Sign In for Pricing
View Details
Rabbit Monoclonal Myosin heavy chain 11 Antibody (MYH11/8185R) [PE]
NBP3-24304PE 0.1 mL

Rabbit Monoclonal Myosin heavy chain 11 Antibody (MYH11/8185R) [PE]

Sign In for Pricing
View Details