NTproBNP (1-76)
NT-proBNP is metabolized by the kidneys and is greatly affected by renal function, and ACE inhibitors/ARBs, β-blockers, adrenergic antagonists, and diuretics can reduce the concentration of NT-proBNP, so it is necessary to measure the basal level of NT-proBNP before drug treatment as a reference for diagnosis, prognosis, and efficacy evaluation.
Product Specifications
Purity
≥95%
Molecular Weight
8457.57
Notes
For research use only.
AA Sequence
HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGH
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9393463 Inquire
Fish WAP, Kazal, Immunoglobulin, Kunitz and NTR Domain-Containing Protein 2 (WFIKKN2) ELISA Kit
Sign In for Pricing
View Details 
HY-113359AS2 1 mg (100 mM in 23.42 μL Tris HCl/H2O buffer pH=7.5)
Uridine 5'-diphosphate-13C9,15N2 (dilithium)
Sign In for Pricing
View Details