Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHRF (1-44), human

Growth Hormone Releasing FactorGHRF (1-44), human Overview Properties Growth hormone-releasing factor (GHRF) is a hypothalamic peptide which positively regulates the synthesis and secretion of growth hormone in the anterior pituitary. The amino-acid sequence of a 43-residue GHRF peptide isolated from rat hypothalamus was recently determined.

Product Specifications

Purity

≥95%

Molecular Weight

5039.7

Notes

For research use only.

AA Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RB (PTPRC/1132), CF405S conjugate, 0.1mg/mL
BNC041132-100 1x 100 µL

CD45RB (PTPRC/1132), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse H2-Q4 activation kit by CRISPRa
GA201824 1 Kit

Mouse H2-Q4 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Rat Ceacam1/BGP-1 protein (His Tag)
PDER100161-01 20 µg

Recombinant Rat Ceacam1/BGP-1 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat Ceacam1/BGP-1 protein (His Tag)
PDER100161-02 100 µg

Recombinant Rat Ceacam1/BGP-1 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat Ceacam1/BGP-1 protein (His Tag)
PDER100161-03 500 µg

Recombinant Rat Ceacam1/BGP-1 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat Ceacam1/BGP-1 protein (His Tag)
PDER100161-04 1 mg

Recombinant Rat Ceacam1/BGP-1 protein (His Tag)

Sign In for Pricing
View Details