Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rec IGF-II (1-67) (human)

Approx. ED50 = 0.1 ng/mL IGF-II seems to be specifically involved in fetal growth, but otherwise shows similar biological activities to IGF-I.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

524.564

Notes

For research use only.

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC5AC Antibody
orb2638930 100 µg

MUC5AC Antibody

Sign In for Pricing
View Details
Tedizolid phosphate disodium salt
orb1706420-01 25 mg

Tedizolid phosphate disodium salt

Sign In for Pricing
View Details
Tedizolid phosphate disodium salt
orb1706420-02 50 mg

Tedizolid phosphate disodium salt

Sign In for Pricing
View Details
Tedizolid phosphate disodium salt
orb1706420-03 100 mg

Tedizolid phosphate disodium salt

Sign In for Pricing
View Details
OR8J1 Peptide - C-terminal region
orb2003265 100 µg

OR8J1 Peptide - C-terminal region

Sign In for Pricing
View Details
ZNF175 Protein Vector (Human) (pPM-C-HA)
PV047403 500 ng

ZNF175 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details