Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8J1 Peptide - C-terminal region

OR8J1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR8J1

UniProt

Q8NGP2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8J1 Rabbit Polyclonal Antibody (orb587652) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005205

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPETVVFISAATNVVGSLIIVLVSYFNIVLSILKICSSEGRKKAFSTCAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-BLNK (p-Tyr96) Antibody Blocking Peptide
orb1505483 500 µg

Phospho-BLNK (p-Tyr96) Antibody Blocking Peptide

Sign In for Pricing
View Details
Hypoxia Up-Regulated Protein 1 (HYOU1) Antibody (ATTO 680)
abx441772 100 µg

Hypoxia Up-Regulated Protein 1 (HYOU1) Antibody (ATTO 680)

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF687 Antibody [Alexa Fluor 647]
NBP2-41128AF647 0.1 mL

Rabbit Polyclonal ZNF687 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
CCDC57 (NM_198082) Human Tagged ORF Clone
RG211646 10 µg

CCDC57 (NM_198082) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 6S1 (OR6S1)
MBS7025078-01 0.02 mg

Recombinant Human Olfactory receptor 6S1 (OR6S1)

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 6S1 (OR6S1)
MBS7025078-02 0.1 mg

Recombinant Human Olfactory receptor 6S1 (OR6S1)

Sign In for Pricing
View Details