Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRF (free acid) (human)

GRF (free acid) (human)

Product Specifications

Purity

≥95%

Molecular Weight

5040.74

Notes

For research use only.

AA Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFM1 antibody
FNab03430 100 µg

GFM1 antibody

Sign In for Pricing
View Details
ATP5D Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV677440 1.0 µg DNA

ATP5D Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Anti-Human CD325/CDH2 Antibody (E4#)
MBS1579737-01 0.05 mg

Anti-Human CD325/CDH2 Antibody (E4#)

Sign In for Pricing
View Details
Anti-Human CD325/CDH2 Antibody (E4#)
MBS1579737-02 0.1 mg

Anti-Human CD325/CDH2 Antibody (E4#)

Sign In for Pricing
View Details
Anti-Human CD325/CDH2 Antibody (E4#)
MBS1579737-03 5x 0.1 mg

Anti-Human CD325/CDH2 Antibody (E4#)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Ornithine carbamoyltransferase (argF)
MBS1043936-01 0.02 mg (E-Coli)

Recombinant Staphylococcus epidermidis Ornithine carbamoyltransferase (argF)

Sign In for Pricing
View Details