Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLP-2 (1-33) (human)

GLP-2 (1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.

Product Specifications

Purity

≥95%

Solubility

Water: 25mg/mL

Molecular Weight

3766.2

Notes

For research use only.

AA Sequence

HADGSFSDEMNTILDNLAARDFINWLIQTKITD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEXB antibody
70R-51557 100 µL

HEXB antibody

Sign In for Pricing
View Details
LRRC19 Rabbit Polyclonal Antibody (C-term)
E28PB1983 100 µL

LRRC19 Rabbit Polyclonal Antibody (C-term)

Sign In for Pricing
View Details
HSPA1B Peptide - C-terminal region
orb2007678 100 µg

HSPA1B Peptide - C-terminal region

Sign In for Pricing
View Details
CLEC10A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0463406 1.0 µg DNA

CLEC10A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Ythdf1 3'UTR Lenti-reporter-Luc Vector
50636084 1.0 µg

Ythdf1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
NVL siRNA (Human)
orb1864978-01 15 nmol

NVL siRNA (Human)

Sign In for Pricing
View Details