Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA1B Peptide - C-terminal region

HSPA1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ54328, HSP70-1B, HSP70-2, HSPA1A

UniProt

P08107

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPA1B Rabbit Polyclonal Antibody (orb585795) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005337

Preservative

Lyophilized powder

AA Sequence

DKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cytochrome P450 2A6/CYP2A6 Antibody Picoband® (Dylight488 Conjugate)
A00947-2-Dylight488 100 µg

Anti-Cytochrome P450 2A6/CYP2A6 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Human Cystatin-D, CST5 ELISA KIT
ELI-26473h 96 Tests

Human Cystatin-D, CST5 ELISA KIT

Sign In for Pricing
View Details
Hsp70 1B Antibody (YA358, Rabbit)
HY-P80713-01 10 µL

Hsp70 1B Antibody (YA358, Rabbit)

Sign In for Pricing
View Details
Hsp70 1B Antibody (YA358, Rabbit)
HY-P80713-02 50 μL

Hsp70 1B Antibody (YA358, Rabbit)

Sign In for Pricing
View Details
Hsp70 1B Antibody (YA358, Rabbit)
HY-P80713-03 100 µL

Hsp70 1B Antibody (YA358, Rabbit)

Sign In for Pricing
View Details
Anti-PC1/3/PCSK1 Antibody Picoband®, Dylight550 Conjugate
PA2084-Dylight550 100 µg

Anti-PC1/3/PCSK1 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details