Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide W-30 (human)

Neuropeptide W-30 is a peptide that has been shown to activate the receptor for neuropeptide W (NPW) . Neuropeptide W is a member of the tachykinin family of peptides, which are known to function as activators of G protein-coupled receptors. Neuropeptide W-30 has been shown to be a potent inhibitor of ion channels and ligand-gated ion channels, including potassium channels, calcium channels, and sodium channels. Neuropeptide W-30 also blocks the release of neurotransmitters such as acetylcholine, noradrenaline, dopamine, and serotonin in animal cells.

Product Specifications

Purity

≥95%

Molecular Weight

3543.17

Notes

For research use only.

AA Sequence

WYKHVASPRYHTVGRAAGLLMGLRRSPYLW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS702791 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
SHP2 (PTPN11) Rabbit Polyclonal Antibody
AP20278PU-N 100 µg

SHP2 (PTPN11) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL 1 alpha Porcine
OM296800-01 10 µg

IL 1 alpha Porcine

Sign In for Pricing
View Details
IL 1 alpha Porcine
OM296800-02 2 µg

IL 1 alpha Porcine

Sign In for Pricing
View Details
IL 1 alpha Porcine
OM296800-03 0.1 mg

IL 1 alpha Porcine

Sign In for Pricing
View Details
S-Trityl-L-cysteine
TRC-T887350-50MG 50 mg

S-Trityl-L-cysteine

Sign In for Pricing
View Details