Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP (3 - 42), human

GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo.

Product Specifications

Purity

≥95%

Solubility

Water: 50 mg/mL. DMSO: 100 mg/mL

Molecular Weight

4749.38

Notes

For research use only.

AA Sequence

EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chitin synthase inhibitor 3
HY-150584 1 Each

Chitin synthase inhibitor 3

Sign In for Pricing
View Details
(2E,23Z,26Z,29Z,32Z) -Octatriacontapentaenoyl-CoA
HY-CE00201A 1 Each

(2E,23Z,26Z,29Z,32Z) -Octatriacontapentaenoyl-CoA

Sign In for Pricing
View Details
Mouse MIP-1Alpha/CCL3 ELISA Kit
EK5188 96 Tests

Mouse MIP-1Alpha/CCL3 ELISA Kit

Sign In for Pricing
View Details
KITH_HHV1S Antibody
MBS859063-01 0.1 mg

KITH_HHV1S Antibody

Sign In for Pricing
View Details
KITH_HHV1S Antibody
MBS859063-02 0.1 mL (AF635)

KITH_HHV1S Antibody

Sign In for Pricing
View Details
KITH_HHV1S Antibody
MBS859063-03 0.1 mL (AF610)

KITH_HHV1S Antibody

Sign In for Pricing
View Details