Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEAP-2 (38 - 77) (Human)

The native and reduced forms of LEAP-2 have similar antimicrobial activities which suggests that the disulfide bridges are not essential for activity.

Product Specifications

Field of Research

Immunology & Inflammation

Purity

≥95%

Molecular Weight

4585.36

Notes

For research use only.

AA Sequence

MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAIAP2, Human recombinant
P1030-100 100 µg

BAIAP2, Human recombinant

Sign In for Pricing
View Details
Formin-binding protein 1 Antibody (Fluoro550)
orb3168199 100 µg

Formin-binding protein 1 Antibody (Fluoro550)

Sign In for Pricing
View Details
MIF Antibody Blocking Peptide
orb72964 500 µg

MIF Antibody Blocking Peptide

Sign In for Pricing
View Details
SRF Antibody
orb673012-01 50 µg

SRF Antibody

Sign In for Pricing
View Details
SRF Antibody
orb673012-02 100 µg

SRF Antibody

Sign In for Pricing
View Details
Lentiviral mouse Tent5a shRNA (UAS) - Lentiviral mouse Tent5a shRNA (UAS, GFP) plasmid
GTR15189694 1 Vial

Lentiviral mouse Tent5a shRNA (UAS) - Lentiviral mouse Tent5a shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details