Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEAP-2 (38 - 77) (Human)

The native and reduced forms of LEAP-2 have similar antimicrobial activities which suggests that the disulfide bridges are not essential for activity.

Product Specifications

Field of Research

Immunology & Inflammation

Purity

≥95%

Molecular Weight

4585.36

Notes

For research use only.

AA Sequence

MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC15A4 Rabbit Polyclonal Antibody (HRP)
orb2119703 100 µL

SLC15A4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
CSNK1A1 Polyclonal Antibody
MBS2519910-01 0.02 mL

CSNK1A1 Polyclonal Antibody

Sign In for Pricing
View Details
CSNK1A1 Polyclonal Antibody
MBS2519910-02 0.06 mL

CSNK1A1 Polyclonal Antibody

Sign In for Pricing
View Details
CSNK1A1 Polyclonal Antibody
MBS2519910-03 0.12 mL

CSNK1A1 Polyclonal Antibody

Sign In for Pricing
View Details
CSNK1A1 Polyclonal Antibody
MBS2519910-04 0.2 mL

CSNK1A1 Polyclonal Antibody

Sign In for Pricing
View Details
POU2F1 (POU Class 2 Homeobox 1, OCT1, OTF1) (AP)
MBS6451421-01 0.1 mL

POU2F1 (POU Class 2 Homeobox 1, OCT1, OTF1) (AP)

Sign In for Pricing
View Details