Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC15A4 Rabbit Polyclonal Antibody (HRP)

SLC15A4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PHT1, PTR4, FP12591

UniProt

Q8N697

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC15A4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_663623

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC3 (10F1/6), CF640R conjugate, 0.1mg/mL
BNC402842-500 1x 500 µL

XRCC3 (10F1/6), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
6-a-D-Glucopyranosyl Maltotriose
TRC-G419100-50MG 50 mg

6-a-D-Glucopyranosyl Maltotriose

Sign In for Pricing
View Details
Tryptase (Mast Cell Marker) (TPSAB1/1961), CF640R conjugate, 0.1mg/mL
BNC401961-500 1x 500 µL

Tryptase (Mast Cell Marker) (TPSAB1/1961), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMEM16A (ANO1) Mouse Monoclonal Antibody [Clone ID: DOG1.1]
AM33350PU-S 100 µg

TMEM16A (ANO1) Mouse Monoclonal Antibody [Clone ID: DOG1.1]

Sign In for Pricing
View Details
Fumarate hydratase Recombinant Rabbit Monoclonal Antibody [PSH08-80]
HA723032 100 µL

Fumarate hydratase Recombinant Rabbit Monoclonal Antibody [PSH08-80]

Sign In for Pricing
View Details
HSP90AB1 (NM_007355) Human Over-expression Lysate
LY402141 100 µg

HSP90AB1 (NM_007355) Human Over-expression Lysate

Sign In for Pricing
View Details