Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-49)

β-amyloid (1-49) is a fragment of Amyloid-β peptide, maybe used in the research of neurological disease.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

5254.1

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAN16 sgRNA CRISPR Lentivector set (Human)
K2508001 3x 1.0 µg

TRNAN16 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Cdkn2c (NM_001301368) AAV Particle
MR228250A1V 250 µL

Mouse Cdkn2c (NM_001301368) AAV Particle

Sign In for Pricing
View Details
ATP1A3 Rabbit Polyclonal Antibody
TA373807 100 µL

ATP1A3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H1.4 (Acetyl K53) Polyclonal Antibody
bs-0931R 100 µL

Histone H1.4 (Acetyl K53) Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human UCMA
MBS7610960-01 0.05 mg

Recombinant Human UCMA

Sign In for Pricing
View Details
Recombinant Human UCMA
MBS7610960-02 0.2 mg

Recombinant Human UCMA

Sign In for Pricing
View Details