Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5a Anaphylatoxin (human)

C5a Anaphylatoxin (human)

Product Specifications

Purity

≥95%

Notes

For research use only.

AA Sequence

TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRAM, CT (Damage-regulated autophagy modulator) (PE)

MBS6293487-01 0.2 mL

DRAM, CT (Damage-regulated autophagy modulator) (PE)

Sign In for Pricing

DRAM, CT (Damage-regulated autophagy modulator) (PE)

MBS6293487-02 5x 0.2 mL

DRAM, CT (Damage-regulated autophagy modulator) (PE)

Sign In for Pricing

RutB Antibody

orb828912 2 mg

RutB Antibody

Sign In for Pricing

NHLH2 Rabbit Polyclonal Antibody (HRP)

orb2082587 100 µL

NHLH2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing

MT-ND1 Antibody

MBS7132469-01 0.1 mL

MT-ND1 Antibody

Sign In for Pricing

MT-ND1 Antibody

MBS7132469-02 5x 0.1 mL

MT-ND1 Antibody

Sign In for Pricing